PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna10329.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 340aa    MW: 38450.6 Da    PI: 9.5781
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna10329.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-15453148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                             r+rW +eEd ll  +vkq+G++ W++++++mg   +R +k+c +rw +yl
  mrna10329.1-v1.0-hybrid  4 RQRWQPEEDALLRAYVKQYGPREWALVSQRMGqpINRDPKSCLERWKNYL 53
                             89********************************99************97 PP

2Myb_DNA-binding361.6e-1159103147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +g+ ++eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  mrna10329.1-v1.0-hybrid  59 KGSLSPEEQSLVIELQAKYGNK-WKKIAAELP-GRTPKRLGKWWEVF 103
                              57789*****************.*********.*****999999776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.493157IPR017930Myb domain
SMARTSM007175.5E-14355IPR001005SANT/Myb domain
PfamPF002492.5E-14453IPR001005SANT/Myb domain
SuperFamilySSF466893.4E-22499IPR009057Homeodomain-like
CDDcd001671.30E-8653No hitNo description
Gene3DG3DSA:1.10.10.603.4E-20660IPR009057Homeodomain-like
SMARTSM007171.2E-958106IPR001005SANT/Myb domain
PROSITE profilePS5129419.31958108IPR017930Myb domain
PfamPF002496.4E-1059100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-1661107IPR009057Homeodomain-like
CDDcd001672.89E-663100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MKERQRWQPE EDALLRAYVK QYGPREWALV SQRMGQPINR DPKSCLERWK NYLRPGLKKG  60
SLSPEEQSLV IELQAKYGNK WKKIAAELPG RTPKRLGKWW EVFRDKQLKH LSKLHPSAAA  120
GTAASSSSST PPEGNIPISS PERAAQGPYD HILETFAEKY VQPKLYTLTV EPDPNISLGS  180
GLPPWMNPPS ATTSTSSSAT ASPSVSLSLS PSDPGHDPDP TRVGMIVQWC KEVEEGRQSW  240
VQHKKEATWR LSRLEQQLEA EKARKRREAV EEVEAKIRAL REEEAAFMGR IESECREQMS  300
VLQREAESKE AKLVEAWCSK HVRLAKLVDR IGSWPSFSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2kdz_A8e-16101107104MYB24
2k9n_A8e-16101107104MYB24
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004304144.10.0PREDICTED: protein rough sheath 2 homolog
SwissprotQ94IB11e-101RS2_ORYSJ; Protein rough sheath 2 homolog
TrEMBLQ2LMD81e-155Q2LMD8_MALDO; MYB92
STRINGPOPTR_0004s10250.11e-140(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25973369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.14e-58MYB family protein